PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000122897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 610aa    MW: 68705.6 Da    PI: 10.1762
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000122897genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.22.2e-11219268857
                    -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    t+ q+e+Le+++ +++yps++++e  A+  gLt +qV+ WF  +R +ek+
  MDP0000122897 219 TQLQVEALESFYSEEKYPSQTAMECHAAAFGLTYKQVRGWFVEKRRREKR 268
                    899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-10210270IPR009057Homeodomain-like
SMARTSM003891.3E-5212273IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.0E-11217273IPR009057Homeodomain-like
CDDcd000863.97E-7217268No hitNo description
PfamPF000461.1E-8219268IPR001356Homeobox domain
PROSITE profilePS5007112.115219269IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MSKNPRPTRS VSPPGSSHLT HRRXSLXCSP PPSSNVDLSS VRHHHHPLGL ISXPHFLNLL  60
LSLTFTLQNS LISTKKPSST TIIFLARFKS EPPKSVFGWL DDHVMCLHGR SEAATVNPLS  120
FGDVKDLKDE XHSESGWXSK PKKEKKRRTY GLVPNRQSMQ ITELTLPTPF FCNSXTAAHA  180
PTSPAALLLE NGGEVSMIFC DFEKLERKGK MMEKIKKKTQ LQVEALESFY SEEKYPSQTA  240
MECHAAAFGL TYKQVRGWFV EKRRREKRGN RTSELGAGAT GIDKHGPSRT KAPPSSRYMK  300
TSLLTKKERM KWNHIQELLT PDYILKKVFR KDGPPLGVEF DSLPSGARCH SPGERLNSLT  360
YGCFVIFKRF SLNVIHTLRR FHSHCNFRLD SPNFLSPCEE NDRATKRRKD CNKSAPVQKH  420
GVGKGLITNH QDCNKRAPVQ KHGVGKGLMT VWQATNPNAR DFPIEMGLAN GEVSSVSLIR  480
TSLSQKPVTR NRRLQPKKCV PMEANNXNQK FPGKEKCELA LEGTGSQEHX DKIAMLVDDE  540
ELEQRELQXR PNSLGCSDHF TNGDHACSLC KDLLAKFPPN SVTMKLPFDM QPWDSSPEIV  600
KKLFKLVVTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359978.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423670, partial
TrEMBLM5X3K81e-139M5X3K8_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61181519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.13e-50Homeodomain-like transcriptional regulator